PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 241aa    MW: 27473.5 Da    PI: 4.6071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039735genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +v+++G  +W+  ++  g++R++k+c++rw +yl
      Lus10039735 13 KGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLKRCGKSCRLRWMNYL 60
                     799*****************99************************97 PP

2Myb_DNA-binding40.18.4e-1366110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE+e ++++++ lG++  + Ia++++ gR ++++k++w++ 
      Lus10039735  66 RGNYSAEEEETILRLHASLGNK-LSVIAAHLP-GRADNEIKNYWHTN 110
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.64864IPR017930Myb domain
SuperFamilySSF466891.31E-2710107IPR009057Homeodomain-like
SMARTSM007171.0E-101262IPR001005SANT/Myb domain
PfamPF002498.8E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-231467IPR009057Homeodomain-like
CDDcd001675.85E-91560No hitNo description
PROSITE profilePS5129413.11365115IPR017930Myb domain
SMARTSM007172.5E-1165113IPR001005SANT/Myb domain
PfamPF002491.5E-1166110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2168113IPR009057Homeodomain-like
CDDcd001674.75E-768111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MRTPSCDENG MRKGTWTAEE DRKLIAYVTR YGCWNWRQLP KFAGLKRCGK SCRLRWMNYL  60
RPDIKRGNYS AEEEETILRL HASLGNKLSV IAAHLPGRAD NEIKNYWHTN LKNRPKQESE  120
QREEIDNTML PAEEEVQVVD QTNNNLLQSP DQSETCSSLS SSFGFGNEAT SVAACSEFLL  180
SDSNCFEDVW EAEAAAAAAG VYYEGSWEPL LTIDNYWYMP SELFETLVTD HQEPQSPLFH  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24111145107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011048479.12e-71PREDICTED: myb-related protein Myb4-like
TrEMBLB9I6H84e-71B9I6H8_POPTR; Uncharacterized protein
STRINGPOPTR_0013s14560.11e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.15e-55myb domain protein 41